Protein Info for DVU0090 in Desulfovibrio vulgaris Hildenborough JW710

Name: wcaG
Annotation: GDP-fucose synthetase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01370: Epimerase
  • amino acids 7 to 238 (232 residues), 220.3 bits, E=4.1e-69
• PF16363: GDP_Man_Dehyd
  • amino acids 39 to 257 (219 residues), 59.6 bits, E=5.8e-20

Best Hits

Swiss-Prot: 65% identical to FCL2_ARATH: Putative GDP-L-fucose synthase 2 (GER2) from Arabidopsis thaliana

KEGG orthology group: K02377, GDP-L-fucose synthase [EC: 1.1.1.271] (inferred from 100% identity to dvu:DVU0090)

MetaCyc: 64% identical to GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase (Arabidopsis thaliana col)
GDP-L-fucose synthase. [EC: 1.1.1.271]

Predicted SEED Role

"GDP-L-fucose synthetase (EC 1.1.1.271)" in subsystem Capsular heptose biosynthesis or Colanic acid biosynthesis (EC 1.1.1.271)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (10/11 steps found)
• GDP-L-fucose biosynthesis I (from GDP-D-mannose) (3/3 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (8/14 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.271

Sequence Analysis Tools

See Q72FX3 at UniProt or InterPro

Protein Sequence (323 amino acids)

>DVU0090 GDP-fucose synthetase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MEKNDKIYVAGHRGLVGGAIVRNLRSRGFGNLLMRSSAELDLRCQRAVEDFFAAERPDYV
FLAAAKVGGILANDTYPADFIRDNLQMEVNVIDAAHRAGVRKLCFLGSSCIYPKFAPQPM
KEEHLLTGELEPTNEWYAVAKIAGIKMCQAYRRQYGFNAIAVMPTNLYGPGDNFDLSGSH
VLPALLRKFHEAKQAGEPEVVVWGTGTPRREFLHVDDMADACVHLMEVYEGENIVNVGVG
EDVTIAELAGLVGQVVGYTGRIVYDASKPDGTPRKLLDVTRLAATGWRAHIGLAEGITST
YAWYLEHLGGRASAGGQTVHGGA