Protein Info for DVU0088 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: Sodium/pantothenate symporter (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details amino acids 241 to 259 (19 residues), see Phobius details amino acids 280 to 302 (23 residues), see Phobius details amino acids 324 to 354 (31 residues), see Phobius details amino acids 377 to 395 (19 residues), see Phobius details amino acids 401 to 424 (24 residues), see Phobius details amino acids 432 to 450 (19 residues), see Phobius details amino acids 456 to 477 (22 residues), see Phobius details TIGR02119: sodium/pantothenate symporter" amino acids 8 to 479 (472 residues), 625.5 bits, see alignment E=7.1e-192 PF00474: SSF" amino acids 42 to 441 (400 residues), 323.1 bits, see alignment E=1.4e-100 TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 42 to 441 (400 residues), 269 bits, see alignment E=7.6e-84

Best Hits

KEGG orthology group: K14392, sodium/pantothenate symporter (inferred from 100% identity to dvl:Dvul_2874)

Predicted SEED Role

"Pantothenate:Na+ symporter (TC 2.A.21.1.1)" in subsystem Coenzyme A Biosynthesis (TC 2.A.21.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FX5 at UniProt or InterPro

Protein Sequence (495 amino acids)

>DVU0088 Sodium/pantothenate symporter (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSAQFMTTVPVVLYLALSFGVALWARGRTAEGGSAKDIIEEYYIGGRSMGGFVLAMTIIA
SYTSAGSFVGGPGVAYRLGLSWVLLAMIQVPTTFLTLGVLGKRFAIVARRAGAVTLTDYL
LARYRSHTVVILCSAALLVFFMAAMLAQFIGGARLFQTVTGYPYVVGLALFGVTVVLYTA
VGGFRAVVVTDAVQGIVMVVAVVVVLLAVIDAGGGMTQCIATLKAIDPGLITPTGPGDAV
PQPFMLSFWVLVGLGVLGLPQTTQRCMGYRDSRAMHDAMIIGTLLIGFMILCAHLAGTLG
RAVLPDLPAGDLAMPSLIVQLLSPFWAGVFIAGPLAAIMSTVDSMLLLASAAIVKDLYVR
YRLGGDTSRLRPVTMKRMSVASTAVIGVLVFVAAMEPPDLLVWINLFAFGGLEAVFLWPL
VLGLYWRRGNATGAIASILSGVTAFVWLTIAKPDMGGIHAIVPTTLLSLVMFVAGSLAGR
PSGREVDALFGGERS