Protein Info for DVU0080 in Desulfovibrio vulgaris Hildenborough JW710

Name: fumC
Annotation: fumarate hydratase, class II (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 transmembrane" amino acids 220 to 238 (19 residues), see Phobius details TIGR00979: fumarate hydratase, class II" amino acids 6 to 461 (456 residues), 684.9 bits, see alignment E=2.6e-210 PF00206: Lyase_1" amino acids 14 to 344 (331 residues), 341 bits, see alignment E=7.7e-106 PF10415: FumaraseC_C" amino acids 410 to 463 (54 residues), 72.3 bits, see alignment 3.5e-24

Best Hits

Swiss-Prot: 60% identical to FUMC_THEEB: Fumarate hydratase class II (fumC) from Thermosynechococcus elongatus (strain BP-1)

KEGG orthology group: K01679, fumarate hydratase, class II [EC: 4.2.1.2] (inferred from 100% identity to dvl:Dvul_2881)

MetaCyc: 59% identical to fumarase C (Escherichia coli K-12 substr. MG1655)
Fumarate hydratase. [EC: 4.2.1.2]

Predicted SEED Role

"Fumarate hydratase class II (EC 4.2.1.2)" in subsystem TCA Cycle (EC 4.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.2

Use Curated BLAST to search for 4.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FY3 at UniProt or InterPro

Protein Sequence (468 amino acids)

>DVU0080 fumarate hydratase, class II (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MMTPAVRIEHDSMGAVEVPADRYWGAQTQRALEHFRIGTERMPQEMVQALGLIKRAAAET
NAALELLPRQTADAVARAATEVASGALPNHFPLCVWQTGSGTQTNMNVNEVVANRACELL
GGVRGDRKLVHPNDHVNLCQSSNDVFPAAMHIAAALGLRSMLLPSLQALEAELEARAHEF
AGLVKVGRTHLQDAVPLTLGQEFSGYAAQLALCRRQLEGMMPLLCALALGGTAVGTGLNA
HPEFARRAVARLAGYTGLPFLPVDNPFAALAGHEALVAYSGALRTLAVALFKVGNDIRLL
ASGPRCGIGELELPANEPGSSIMPGKVNPTQCEALTMVAVQVMGLDNAVGIAGSQGHLEL
NVFKPLIARNVLESARLLADSMRSFRMHAVRGLRAVPERIASHVDRSLMLVTALSRHVGY
DRAAEVAHLAHAEGLTLREACLRLGLMDGEAFDRAVDPVRMAHPHDMG