Protein Info for DVU0077 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: conserved hypothetical protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 47 to 64 (18 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 97 to 113 (17 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details amino acids 143 to 167 (25 residues), see Phobius details PF11744: ALMT" amino acids 23 to 201 (179 residues), 38.6 bits, see alignment E=1.3e-13 PF04632: FUSC" amino acids 23 to 349 (327 residues), 110.1 bits, see alignment E=2.6e-35 PF06081: ArAE_1" amino acids 27 to 163 (137 residues), 49.4 bits, see alignment E=1.1e-16 PF13515: FUSC_2" amino acids 35 to 160 (126 residues), 74 bits, see alignment E=2.5e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0077)

Predicted SEED Role

"FIG00603567: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FY6 at UniProt or InterPro

Protein Sequence (360 amino acids)

>DVU0077 conserved hypothetical protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MDGRALCGRAVRGLRSRVPGASVRHGIKTGLAALLSYLVTEWLHLDFGYWAPITAVIVMQ
TSVAESIEMSLYRTVGTMIGALMGVVSILALPDTFEGNGAGLFITTGLCAFLTRWDARYR
MAAITVTIVILASVGQPDRMHFGLFRVLEILVGVVCAVLVSLTLWPLRAGEALRADLARQ
LQAAAERVGVLVEAFLAEQQALPEDMFDGVAGTLKSNHDRLRKARRHESFLHRDDHEHLE
ALVMATDHAASHLQAMLHSLNGCRGEGYTIIMAKELRDLAAAASEGLRWLAAPDAATPPP
ALRGVIDAAEARLAALREDGATRRFYLGKLMQFYAFYHALRRLAEDVEAIVERRQACSMA