Protein Info for DVU0058 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: efflux transporter, RND family, MFP subunit (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 45 to 373 (329 residues), 191.7 bits, see alignment E=8.2e-61 PF16576: HlyD_D23" amino acids 89 to 286 (198 residues), 61.7 bits, see alignment E=9.4e-21 PF13533: Biotin_lipoyl_2" amino acids 90 to 120 (31 residues), 23.7 bits, see alignment (E = 5e-09) PF13437: HlyD_3" amino acids 187 to 278 (92 residues), 34.9 bits, see alignment E=3.3e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2903)

Predicted SEED Role

"Probable RND efflux membrane fusion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72G05 at UniProt or InterPro

Protein Sequence (383 amino acids)

>DVU0058 efflux transporter, RND family, MFP subunit (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRLMRLLPLLGLLALAACGDEQGVREASRPVGVEVAAPLEGVTGRRYTATLEPREQVSVA
FRVGGYVEDILTVSAGAEAKGNNARRVDAERGDRVRKGQVLARLRTTDYQGRVAAARGAV
DEAVAARRQSALDLERLGTLLRDKAVAQADYDRAREKADATVAREEAARGRLAEALDQLR
DTALICPLDGVLTKRSVERGTLATPGMVAYVVADMTRMKAVFGVPDTLVDAVRPGAHLDV
LVPSVGVAQQGRVTAVSPAADKRSRIFDVEVTLDNAGGLLREGMSATVELGGGSAGPAPA
VPLAAVVRPAGRAEGYAVFVVEDVDGGTVAHEREVVLGIVEGSRVELTQGVRPGERVVVL
GATLLHDGEHVRVLPGGAEVAPR