Protein Info for DVU0052 in Desulfovibrio vulgaris Hildenborough JW710

Name: era
Annotation: GTP-binding protein Era (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 TIGR00436: GTP-binding protein Era" amino acids 10 to 287 (278 residues), 244.6 bits, see alignment E=1.2e-76 TIGR00231: small GTP-binding protein domain" amino acids 10 to 175 (166 residues), 72.9 bits, see alignment E=2.6e-24 PF00025: Arf" amino acids 11 to 176 (166 residues), 24.7 bits, see alignment E=7.3e-09 PF01926: MMR_HSR1" amino acids 11 to 131 (121 residues), 88.2 bits, see alignment E=2.1e-28 PF02421: FeoB_N" amino acids 11 to 173 (163 residues), 50.7 bits, see alignment E=7.2e-17 PF07650: KH_2" amino acids 215 to 292 (78 residues), 73.1 bits, see alignment E=6.8e-24

Best Hits

Swiss-Prot: 100% identical to ERA_DESVH: GTPase Era (era) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K03595, GTP-binding protein Era (inferred from 100% identity to dvu:DVU0052)

Predicted SEED Role

"GTP-binding protein Era" in subsystem Bacterial Cell Division or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72G11 at UniProt or InterPro

Protein Sequence (308 amino acids)

>DVU0052 GTP-binding protein Era (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNQTTHRCGWVALIGPPNAGKSTLLNALIGQKVAIVTSKPQTTRNQIVGILSRKDAQVVF
MDTPGIHQLRGRLNKMLLQTAWQSMNAADALIVMLDGDLYIRKPDLLDRDIAPLVEPIAA
ETRPVVVVVNKIDLFRDKSKMLPLLERLSAMWPKAEVFPASALNKDGMDHLLRLIVGYMP
EGPALYPEDQISTLPVRFMTAEIVREKVFNKLRQELPYSTAVDIEQWEEEEGRDQVIVNA
VIYVARPSHKSMVIGKGGATIKEIGIEARKDIQELLEKRVHLELWVKVREGWTEDLGFMR
SLGLSPDE