Protein Info for DVU0042 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: RNA methyltransferase, TrmH family, group 3 (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00186: RNA methyltransferase, TrmH family, group 3
  • amino acids 7 to 238 (232 residues), 160.7 bits, E=2.2e-51
• PF08032: SpoU_sub_bind
  • amino acids 8 to 79 (72 residues), 52.7 bits, E=4.4e-18
• PF00588: SpoU_methylase
  • amino acids 98 to 238 (141 residues), 126.5 bits, E=9e-41

Best Hits

KEGG orthology group: K03218, RNA methyltransferase, TrmH family [EC: 2.1.1.-] (inferred from 100% identity to dvl:Dvul_2919)

Predicted SEED Role

"23S rRNA (guanosine-2'-O-) -methyltransferase rlmB (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See Q72G19 at UniProt or InterPro

Protein Sequence (249 amino acids)

>DVU0042 RNA methyltransferase, TrmH family, group 3 (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
VATDQPVLPGLKPVLELLASDPARIDTVFIRRGRRTPDTDRLMDLCREMRVRFSLVEGQV
LDKLYAGGHQGVVARLFEAGYVELDDLLQDAPDAPLPLIIALDQVQDPGNAGTLARSLYA
LGGAGLIVPRHNAAYLGAGAHRAAAGALEKLPVARVANLARALDEAAEAGYAIYGAMCGE
GSVNAFTATLRTPCVLVLGNEDKGIRPNVAKRCDTLLHIPMLRDFDSFNVAQAGALLLGC
FAAPLLRDR