Protein Info for DVU0034 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: DSBA-like thioredoxin domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13462: Thioredoxin_4" amino acids 89 to 251 (163 residues), 104.5 bits, see alignment E=1.4e-33 PF01323: DSBA" amino acids 100 to 250 (151 residues), 81.1 bits, see alignment E=1.9e-26 PF13743: Thioredoxin_5" amino acids 146 to 234 (89 residues), 30.7 bits, see alignment E=5.5e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2927)

Predicted SEED Role

"Periplasmic thiol:disulfide interchange protein DsbA" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72G27 at UniProt or InterPro

Protein Sequence (261 amino acids)

>DVU0034 DSBA-like thioredoxin domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MFKRLLATLLIVLTLVPVAGAADNRDELKETLRTLLRDNPDLVLEVLREHSETVLEIAQQ
GANQRRRKVLVAQWKTDLEDPKKVNLADRPVRGEANAPVTVVAYSDFTCPYCQQAAGTVE
MLLANYKGKVRYVFKQMPLETHENARTASNYYVAASLQDPAKAWKLYEAVFADRDRLVTE
GEPFLKKVAQEAGLDMQRLATDIKGRKVKALIEEDMAEARKLGVQGTPYFLVNDLVVRGA
LPLDLFSDAVDMALEKAGAKK