Protein Info for DVU0031 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: AzlC family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 37 to 59 (23 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 128 to 154 (27 residues), see Phobius details amino acids 160 to 175 (16 residues), see Phobius details amino acids 182 to 199 (18 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details PF03591: AzlC" amino acids 13 to 153 (141 residues), 147.2 bits, see alignment E=2.2e-47

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2930)

Predicted SEED Role

"AzlC family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72G30 at UniProt or InterPro

Protein Sequence (245 amino acids)

>DVU0031 AzlC family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQGIGEGVRRAFPIVLGYVPVGFAFGVLALKSGIPAWGALAMSLFVFAGSGQLIAVGLIG
GGAPLASVVLTTFVVNLRHLLMSAALAPRLRDWGLLRQALFSAEMTDETFAVHVSTLRGE
ADDPSRAAVFACNVTAHAAWVGGSALGVFCSTLVADVRPLGLDYALAAMFIALLLPQCRS
RAHLFAALVAGACSVGFALSGAGRWNVMLATVCAATLVSLLPVGKTSTTREEMGTPGGEG
GAHAD