Protein Info for DVU0027 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 38 to 58 (21 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 131 to 156 (26 residues), see Phobius details amino acids 168 to 191 (24 residues), see Phobius details amino acids 195 to 200 (6 residues), see Phobius details amino acids 205 to 236 (32 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details amino acids 294 to 310 (17 residues), see Phobius details amino acids 332 to 352 (21 residues), see Phobius details amino acids 372 to 394 (23 residues), see Phobius details amino acids 411 to 430 (20 residues), see Phobius details amino acids 450 to 473 (24 residues), see Phobius details PF16980: CitMHS_2" amino acids 36 to 473 (438 residues), 670.2 bits, see alignment E=1.3e-205

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2935)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72G34 at UniProt or InterPro

Protein Sequence (474 amino acids)

>DVU0027 membrane protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKRLSPALIAATLSLLLAPIAAFASGGHHDLDGSVLTVAWALPFACMLLSIAVMPLALPH
FWHHHFGKVSAFWALAFLVPCAAVFGMQTAIYQVLHTFLLEYVPFLILLFALFTVAGGVR
LKGSLVGTPVVNTAILAVGTLLASWMGTTGAAMLLIRPLLRANSHRRFRVHSVVFFIFLV
ANIGGSLTPLGDPPLFLGFLKGVSFFWTTSHLLMKTILVSVILIAAFFVLDTVLFNREGR
PVPPNAESGEKLGLDGVVNLPLLGGVVALVLMSGLWKPEVAFNVYGIEVELQNLARDLGL
LGIAALSLKLTSTECRRLNEFTWGPIEEVAKLFAGIFVSMIPAIAILKAGEAGALAPVIN
MVTHDGQPVNTMYFWLTGILSSFLDNAPTYLVFFNTAGGDAMHLMNDIPETLAAISAGAV
FMGANTYIGNAPNFMVRSIAEEQGVPMPSFFGYMAWSCGILVPCFILVTWLFFM