Protein Info for DVU0025 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sensory box histidine kinase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 719 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 44 to 64 (21 residues), see Phobius details PF13188: PAS_8" amino acids 80 to 127 (48 residues), 16.8 bits, see alignment 1.5e-06 amino acids 336 to 392 (57 residues), 18.6 bits, see alignment 4e-07 TIGR00229: PAS domain S-box protein" amino acids 84 to 199 (116 residues), 43 bits, see alignment E=2.3e-15 amino acids 333 to 450 (118 residues), 31 bits, see alignment E=1.2e-11 PF08448: PAS_4" amino acids 86 to 191 (106 residues), 32 bits, see alignment E=3.7e-11 PF13426: PAS_9" amino acids 92 to 191 (100 residues), 12 bits, see alignment E=6.2e-05 PF08447: PAS_3" amino acids 231 to 317 (87 residues), 52.9 bits, see alignment E=1.1e-17 PF00989: PAS" amino acids 337 to 379 (43 residues), 24.5 bits, see alignment 6.8e-09 PF02518: HATPase_c" amino acids 599 to 711 (113 residues), 78.6 bits, see alignment E=1.5e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0025)

Predicted SEED Role

"sensory box histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72G36 at UniProt or InterPro

Protein Sequence (719 amino acids)

>DVU0025 sensory box histidine kinase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSCVQFQRCLGAAILHGCAACLSSAALAATAQPPPATDASGLGFVIATTAGAALCVVLLT
LWRLRASSPHRHNRAPAHLVEAVADAGPALLWLSDTQGACIWVNARWRHFTGHSNEAARG
DGWLYAIAAAGRDAARDFARTGASARRPCTMTFPMTRHDGVVRHMVAEGRPYHDTHGHYA
GFCISCLDVTDLMEARRALEESERRFSTLVTNIPGAVYRCSSTPPWHMQFLSAGAANITG
IPVSRFTDGTLTWESIVHPDDRAMLNHPVIEAINAPDGHFSLSYRIITAHGETRHMMEYG
RPVKDSTGNVRYLDGVIFDVTEQQAISEALRDMRDFLHDVLEAMPSALVGFDVQGRVVQW
NRVAESMTGVAAEDALDMPARDATRLLAGDDPRLLLALEHRTPDTFSRLSVYRDDGMHHV
DVQTFTAGVADVLVMRVDDVTRRVRLEEALLQSEKMLSIGGLAAGMAHEMNNPLGAILQG
AQNIQRRLDPALPANRAAAEEAHCPLDAMQSYMVARGIPGFLDGIQNAGARAASLVAHML
EFIRPSQGERTAIGLTTIIDRALALAGNDYSDNMNHDFRTLGIVRDYDPTDDIISCIPAE
LEQVFLNLFRNAAQAMRDKTYPEGISPELHIVTRVLPSEVRVDVIDNGPGISPAVRKRIF
EPFFSTRDAGKGVGMGLAIAYFIITTNHGGTIECASRPGEGTRLTIRLPRDEGTTADPR