Protein Info for DVU0022 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: HAMP domain/GGDEF domain/EAL domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 793 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 271 to 290 (20 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 346 to 510 (165 residues), 106.1 bits, see alignment E=8.2e-35 PF00990: GGDEF" amino acids 350 to 507 (158 residues), 124.3 bits, see alignment E=4.2e-40 PF00563: EAL" amino acids 528 to 765 (238 residues), 225.9 bits, see alignment E=4.8e-71

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0022)

Predicted SEED Role

"Uncharacterized signaling protein CC_0091"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72G39 at UniProt or InterPro

Protein Sequence (793 amino acids)

>DVU0022 HAMP domain/GGDEF domain/EAL domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTVITLVLGMLLPAVVSILMLMASTQSRISEEENMMRAGLVEGMGLQVDEVVDALAQSLE
VIAANGGADADDATRWTRLLQASRAFGKQFLEFHVANPNGDVISSSASLPEGINVADRAY
FSTSLATEGMVASEGLVSRHTGQIALYFALAVRSDEEAHSGVVFAGFNGEVFGDMLRKAG
PRSDGLTVFVLDRNGDSVYEHLPSGGRHPVHIPPADLRDCADGRRAWLEFGGTRHAVSVM
AKRLATGEAPYLYLLVSTPDESFFSLSTLRGVTPLLLGTLCVALAALAAANRRIVHPLES
LTRKVQAIEAGQPLPETAMESVREIGGLQTAVTRMAQAISQREQELAWFATHDDLTGLAN
RKALHEMLAARLDRLEEGASETVAVIFIDIDRFKAINDSMGHTWGDNVIAAFAARLGAFM
HPLHAFCARVGGDEFVVVPDASATHNVVRDTRALLAHLGTPYDINGREVRLSASAGVLFV
GDPGESPDVIIRNANAAMHRSKERGFGRISIFRPLHLDSYMLRLDIERELPLAAATGQLH
MVYQPIVNASDGSLHSFEALMRWNHPRHGSLSPATFITVAEQTGHVGLLGDFALREAGAC
VRRFGEAGLLTPGLRFGVNISPAHLMAQDFLSDIESVLDAVSVPGDRITLEVTESALIST
GAELMGRLETLAKRGLNFAIDDYGAGYSNIQYLASEHFRVIKIDKSLIDEVHLRDRMRAI
VRSTVQLAHSLGCKIVAEGVETHAQANLLARLGCDYLQGYLFSRPVPETDAMRLAIRAMD
QGTLLPPEAHPDA