Protein Info for DVU0010 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: TRAP transporter, DctQ family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 transmembrane" amino acids 22 to 45 (24 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details PF04290: DctQ" amino acids 33 to 161 (129 residues), 109.4 bits, see alignment E=6e-36

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0010)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72G50 at UniProt or InterPro

Protein Sequence (188 amino acids)

>DVU0010 TRAP transporter, DctQ family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MCALRLTARLLDTASEKADRAARLWLITAMAGMAVLVAVQVFSRYALNESLFWSEELGRI
LLVQLTFIGCAVAVRAGAHPGMDALVRHLPRRGRHVTHMLVLLAALAFFALLAWHGARFA
WFVRHQSTPALGLSRLIPALPLPVGGALSMLHVLAILARHATGDRQGGGDDGLADHASDT
PSPTGDRP