Protein Info for DVU3392 in Desulfovibrio vulgaris Hildenborough JW710

Name: glnA
Annotation: glutamine synthetase, type I (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03951: Gln-synt_N
  • amino acids 22 to 104 (83 residues), 98.1 bits, E=1.8e-32
• PF00120: Gln-synt_C
  • amino acids 111 to 443 (333 residues), 437.1 bits, E=4.7e-135

Best Hits

Swiss-Prot: 51% identical to GLN1A_MYCS2: Glutamine synthetase (glnA) from Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)

KEGG orthology group: K01915, glutamine synthetase [EC: 6.3.1.2] (inferred from 100% identity to dvu:DVU3392)

Predicted SEED Role

"Glutamine synthetase type I (EC 6.3.1.2)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Glutamine synthetases or Peptidoglycan Biosynthesis (EC 6.3.1.2)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• ammonia assimilation cycle I (2/2 steps found)
• L-glutamine biosynthesis I (1/1 steps found)
• L-aspartate degradation II (aerobic) (2/3 steps found)
• L-aspartate degradation III (anaerobic) (2/3 steps found)
• superpathway of ammonia assimilation (plants) (2/3 steps found)
• ammonia assimilation cycle II (1/2 steps found)
• L-glutamate and L-glutamine biosynthesis (4/7 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.1.2

Use Curated BLAST to search for 6.3.1.2

Sequence Analysis Tools

See Q725N2 at UniProt or InterPro

Protein Sequence (447 amino acids)

>DVU3392 glutamine synthetase, type I (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MDIPVFNCKNGDDVIRAVKEYNVSFVQFWFVDILGNLKSFQVTPSELEAAFEEGMGFDGS
SILGFTRIEESDMVAFPDATTFQICSWRPLERPVARMFCDIRTPDGTPYEGDPRYILRKL
IDKAAQKGYTFYVGPELEFFFFSSPQCPTPIDAGGYFDAPPLDLGNDVRRDIIFALQRMG
IPVEYSHHEVAPSQHEIDLRYNEAMKMADVVMTYKVVVKEMARKHGIYATFMPKPIFGEN
GSGMHVHQSLFRNGKNAFFDPNDQHNLSHECRSYIAGLLKHAREFCCVTNQWINSYKRLV
PGYEAPVYIAWAQRNRSALIRVPMYKPGKEAATRIELRSPDPACNPYLAFAVMLGAGLEG
IENNYELPKAVEANIFHMGEEDLGKHGIGSLPGSLYEAAMELRNSNLMKEILGEHTHANI
VGNKLIEWDDYRTHISEFELKRYLPIL