Protein Info for DVU3392 in Desulfovibrio vulgaris Hildenborough JW710

Name: glnA
Annotation: glutamine synthetase, type I (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 PF03951: Gln-synt_N" amino acids 22 to 104 (83 residues), 98.1 bits, see alignment E=1.8e-32 PF00120: Gln-synt_C" amino acids 111 to 443 (333 residues), 437.1 bits, see alignment E=4.7e-135

Best Hits

Swiss-Prot: 51% identical to GLN1A_MYCS2: Glutamine synthetase (glnA) from Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)

KEGG orthology group: K01915, glutamine synthetase [EC: 6.3.1.2] (inferred from 100% identity to dvu:DVU3392)

Predicted SEED Role

"Glutamine synthetase type I (EC 6.3.1.2)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Glutamine synthetases or Peptidoglycan Biosynthesis (EC 6.3.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.1.2

Use Curated BLAST to search for 6.3.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725N2 at UniProt or InterPro

Protein Sequence (447 amino acids)

>DVU3392 glutamine synthetase, type I (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MDIPVFNCKNGDDVIRAVKEYNVSFVQFWFVDILGNLKSFQVTPSELEAAFEEGMGFDGS
SILGFTRIEESDMVAFPDATTFQICSWRPLERPVARMFCDIRTPDGTPYEGDPRYILRKL
IDKAAQKGYTFYVGPELEFFFFSSPQCPTPIDAGGYFDAPPLDLGNDVRRDIIFALQRMG
IPVEYSHHEVAPSQHEIDLRYNEAMKMADVVMTYKVVVKEMARKHGIYATFMPKPIFGEN
GSGMHVHQSLFRNGKNAFFDPNDQHNLSHECRSYIAGLLKHAREFCCVTNQWINSYKRLV
PGYEAPVYIAWAQRNRSALIRVPMYKPGKEAATRIELRSPDPACNPYLAFAVMLGAGLEG
IENNYELPKAVEANIFHMGEEDLGKHGIGSLPGSLYEAAMELRNSNLMKEILGEHTHANI
VGNKLIEWDDYRTHISEFELKRYLPIL