Protein Info for DVU3382 in Desulfovibrio vulgaris Hildenborough JW710

Name: zraS
Annotation: sensor protein ZraS (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 679 transmembrane" amino acids 18 to 40 (23 residues), see Phobius details amino acids 266 to 287 (22 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 303 to 417 (115 residues), 32.8 bits, see alignment E=3.4e-12 PF13188: PAS_8" amino acids 306 to 342 (37 residues), 20.6 bits, see alignment 1.2e-07 PF00989: PAS" amino acids 306 to 407 (102 residues), 27.1 bits, see alignment E=1.2e-09 PF08448: PAS_4" amino acids 309 to 412 (104 residues), 38.2 bits, see alignment E=5.4e-13 PF13426: PAS_9" amino acids 319 to 410 (92 residues), 31.7 bits, see alignment E=5.3e-11 PF00512: HisKA" amino acids 428 to 489 (62 residues), 47.9 bits, see alignment 3.9e-16 PF02518: HATPase_c" amino acids 535 to 639 (105 residues), 94.1 bits, see alignment E=2.6e-30

Best Hits

KEGG orthology group: K07709, two-component system, NtrC family, sensor histidine kinase HydH [EC: 2.7.13.3] (inferred from 100% identity to dvu:DVU3382)

Predicted SEED Role

"Sensor protein of zinc sigma-54-dependent two-component system" in subsystem Zinc resistance

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725P2 at UniProt or InterPro

Protein Sequence (679 amino acids)

>DVU3382 sensor protein ZraS (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTPSTVLERLRSRLASPWSLVLLAALLVAGIVAVLLGSYHGAASTMTRILTEKGASLIRS
FEAGARTGMRHSAGLRLQILLEEMADQPDIRFIAVVSPEGEVLAHSDMTRVGTRLFNPDE
LQRLDAGTEPRWTLLPGDGGDDFVVFRLFDPVRRRAMFIPEGGRMAPPPPDDARLEHPDD
QRPRSRAERFARWRERQEGLSPFPGSLPLPEDGRGDTGRREHGGHGMHGGFDASCMRSPQ
GPPPVILVGLDMQPFAEARAQDRNHALLMLALAGGVAVAGVLSLVWSRREQAARRRLMAS
QAFAAKVVSSLPDGLVAFDREGRIDECNAAGADLLGVGASSALGQGASWLPAPLDAMAAY
LLGGGVLAPTEVECRRADGTSVPLGVRGARIVDDEGRAVGVILLLRDLSEVRHLEAEVRR
REKLAAVGNLAAGVAHEIRNPLSSIKGYATYFGTRFPEGSDDREAARVMVQEVDRLNRVI
SDLIGLSRPSDIRPRPTRVADIVDHALRLVRPDAEARKVAVRFEAAPDVPEALVDPDRFA
QALLNVCLNGMEAMGDGGELMVTAYRHGDGRVAVSVRDTGPGISPENLSRVFDPYFTTKG
QGTGLGLAIVHKIIEAHGGEVGFRSEPGHGTECTFILPAVHAGATPDIRADAAGAGQPRA
ATSAGILAGTSDQDTDKGE