Protein Info for DVU3368 in Desulfovibrio vulgaris Hildenborough JW710

Name: hisS
Annotation: histidyl-tRNA synthetase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 TIGR00442: histidine--tRNA ligase" amino acids 6 to 403 (398 residues), 473.6 bits, see alignment E=2.7e-146 PF13393: tRNA-synt_His" amino acids 9 to 312 (304 residues), 132.9 bits, see alignment E=3.1e-42 PF01409: tRNA-synt_2d" amino acids 18 to 155 (138 residues), 24.9 bits, see alignment E=2.7e-09 PF00587: tRNA-synt_2b" amino acids 67 to 297 (231 residues), 52.2 bits, see alignment E=1.6e-17 PF03129: HGTP_anticodon" amino acids 328 to 412 (85 residues), 43.2 bits, see alignment E=7.2e-15

Best Hits

Swiss-Prot: 100% identical to SYH_DESVH: Histidine--tRNA ligase (hisS) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K01892, histidyl-tRNA synthetase [EC: 6.1.1.21] (inferred from 100% identity to dvl:Dvul_0027)

Predicted SEED Role

"Histidyl-tRNA synthetase (EC 6.1.1.21)" (EC 6.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P62379 at UniProt or InterPro

Protein Sequence (417 amino acids)

>DVU3368 histidyl-tRNA synthetase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSKITKIKGFADLFPPESDVFTRMESVARQVFGRYGFVELRTPILERTDLFCRSIGTETD
VVQKEMYTFPDRKDRSLTMRPEATAGVMRAYIESGRHTQEPVSKLFTSGPMFRYERPQKG
RMRQFHQINCEVLGPVEPHADAELVLMLMRFLTELGLTGLSLQINSLGCKECRPLYRKAL
SDFLASIDNAALCEDCRRRMETNPLRVLDCKVPGCRELTANAPTILEHNCPECRTHFDAV
LRILDSRNVPYVLNDRLVRGLDYYNRTTFEVVSDSIGSQGSVAGGGRYDGLISQLGGPDV
PGVGFACGMERLALMMPGADAPRPHFHVAVLDPAAQDAALLLAEDLRAQGLTGSVGFGAG
SIKSRMRLAGKSGARACLILGGDELAAGTVVVKDMDSGEQETIGRDAVAARLLAAGA