Protein Info for DVU3365 in Desulfovibrio vulgaris Hildenborough JW710

Name: fmt
Annotation: methionyl-tRNA formyltransferase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 TIGR00460: methionyl-tRNA formyltransferase" amino acids 7 to 315 (309 residues), 281.5 bits, see alignment E=4.1e-88 PF00551: Formyl_trans_N" amino acids 8 to 187 (180 residues), 145.7 bits, see alignment E=1.4e-46 PF02911: Formyl_trans_C" amino acids 210 to 313 (104 residues), 79.5 bits, see alignment E=1.8e-26

Best Hits

Swiss-Prot: 100% identical to FMT_DESVH: Methionyl-tRNA formyltransferase (fmt) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K00604, methionyl-tRNA formyltransferase [EC: 2.1.2.9] (inferred from 100% identity to dvl:Dvul_0030)

Predicted SEED Role

"Methionyl-tRNA formyltransferase (EC 2.1.2.9)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or Folate Biosynthesis (EC 2.1.2.9)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.9

Use Curated BLAST to search for 2.1.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725Q9 at UniProt or InterPro

Protein Sequence (330 amino acids)

>DVU3365 methionyl-tRNA formyltransferase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAESAPLKIVFMGTPDFAAASLRHLLAWDGCDVVGVYTQPDRPCGRGQQCRPSAVKMLAL
EHGLDVRQPVSFRDEADVQALRDFGADILVVAAYGLILPQSVLDAAPMGAVNVHGSLLPR
YRGAAPIQRAVMNGDAVTGITIMQVVKQLDAGPMLLQKALGIGCDETSGQLHDQLAELGG
RLLVETLARLRAGTIMPIPQDDALATYAAKLTKADGLVDWNRTAVEVHAQVRGVTPWPAA
YFTLRREGQKDVRVTIEPGTIGPLLEQPAVPGTIVGLVDGAIAFACADRTYLVRTIRPAD
KKPMTGEAFWCGYLSRCEGECPGFAVCEGA