Protein Info for DVU3362 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: conserved hypothetical protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 PF09350: DJC28_CD" amino acids 7 to 73 (67 residues), 88.5 bits, see alignment E=1.3e-29

Best Hits

Swiss-Prot: 38% identical to YFLB_BACSU: Uncharacterized protein YflB (yflB) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to dvu:DVU3362)

Predicted SEED Role

"FIG074102: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725R2 at UniProt or InterPro

Protein Sequence (126 amino acids)

>DVU3362 conserved hypothetical protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MDAITLIAEKRITEAQEEGAFENLPGTGKPLSIEDDSLIPEDLRMAYKILRNAGYLPSEI
QDRKEVQTMLELLENCADERDKVRQMRKLEVILRRILDRRGKPVPLSDDDAYYASILERI
TLQPKP