Protein Info for DVU3349 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-binding domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 PF01855: POR_N" amino acids 19 to 192 (174 residues), 169.1 bits, see alignment E=2e-53 PF02780: Transketolase_C" amino acids 249 to 313 (65 residues), 30.3 bits, see alignment E=5.3e-11 PF17147: PFOR_II" amino acids 252 to 340 (89 residues), 74.8 bits, see alignment E=9.7e-25

Best Hits

KEGG orthology group: K00174, 2-oxoglutarate ferredoxin oxidoreductase subunit alpha [EC: 1.2.7.3] (inferred from 100% identity to dvl:Dvul_0045)

Predicted SEED Role

"2-oxoglutarate oxidoreductase, alpha subunit (EC 1.2.7.3)" (EC 1.2.7.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.7.3

Use Curated BLAST to search for 1.2.7.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725S5 at UniProt or InterPro

Protein Sequence (357 amino acids)

>DVU3349 pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-binding domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSSEKTERIFIKGNEAIAHGALAAGCRCYFGYPITPQNDIPEMMSSAIPAAGGEFVQAES
EVAAANMLLGAAACGVRAFTSSSSPGVSLMQEAISYMAGSELPGVIVNMNRGGPGLGDIG
PSQGDYFQSVKGGGHGDYRTYVLAPATCQECYDMMFEAFDVAYRFRTPVLVLGDAIVGQM
KEPVTPWKRDDLDPATEGADWRLQGAKGRPARLLKSLFLEDGALAGQNRNLQAKYEAMKE
LARAECFETEDADLVVVAFGSIGRIAKSAIRKLRAQGHKVGLVRPVTLFPFPEKVLQDLA
AKGKRFLTIEHNCGQMVDDVRLAVRAYCDSDFYGHMPGELPGSDDFLKPILDALGRK