Protein Info for DVU3342 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: hypothetical protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 transmembrane" amino acids 15 to 39 (25 residues), see Phobius details amino acids 106 to 123 (18 residues), see Phobius details PF07811: TadE" amino acids 13 to 54 (42 residues), 49.4 bits, see alignment E=1.9e-17

Best Hits

KEGG orthology group: None (inferred from 99% identity to dvl:Dvul_0052)

Predicted SEED Role

"Similar to TadZ/CpaE, associated with Flp pilus assembly" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725T2 at UniProt or InterPro

Protein Sequence (138 amino acids)

>DVU3342 hypothetical protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKGERSFLHDTEGMTTLEFALVLPLVLLLLFGTMDMLRYVWARNTTVAAAVEAAETGALR
TTTDEEIRLAAERILAPSGLRASSLVITRETAVVPPVITVRITVDFSYIVLPGFLTSMVG
ARVIDITKRSVMGPEESS