Protein Info for DVU3339 in Desulfovibrio vulgaris Hildenborough JW710

Name: kdpA
Annotation: potassium-transporting ATPase, A subunit (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 67 to 87 (21 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 258 to 279 (22 residues), see Phobius details amino acids 286 to 306 (21 residues), see Phobius details amino acids 377 to 401 (25 residues), see Phobius details amino acids 421 to 443 (23 residues), see Phobius details amino acids 487 to 509 (23 residues), see Phobius details amino acids 529 to 551 (23 residues), see Phobius details TIGR00680: K+-transporting ATPase, A subunit" amino acids 1 to 562 (562 residues), 709.8 bits, see alignment E=1.2e-217 PF03814: KdpA" amino acids 11 to 561 (551 residues), 758.8 bits, see alignment E=1.3e-232

Best Hits

Swiss-Prot: 100% identical to KDPA_DESVH: Potassium-transporting ATPase potassium-binding subunit (kdpA) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K01546, K+-transporting ATPase ATPase A chain [EC: 3.6.3.12] (inferred from 100% identity to dvu:DVU3339)

MetaCyc: 52% identical to K+ transporting P-type ATPase subunit KdpA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-2 [EC: 7.2.2.6]

Predicted SEED Role

"Potassium-transporting ATPase A chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12 or 7.2.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725T6 at UniProt or InterPro

Protein Sequence (569 amino acids)

>DVU3339 potassium-transporting ATPase, A subunit (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQLMEYTQLALFLGLLALMSPVLGRFIGRAVLRGEQTWMHSVLGPVERLIYRASGIRPEA
RQSWRQYAASLCAFSAAGFLMTFGVLMLQDKLPLNPQGFPGLSWHLAFNTAVSFLTNTNW
QSYAGESTVSHFSQMVGLAYHNFVSAAAGLAVAVAVMRGLASQESKTIGNFWADLVRSVL
YVLLPISLVLAVVLVGQGVVQTMSAGTEVATLEGGRQFIAMGPTASQVAIKMLGTNGGGF
FNANAAHPLENPTALSNLLQMLAIFIIPSSLVFTLGGAVSNRRHAWTVWFVMACLFMVGA
CSLYRAETLGTPLLTEVAQAPVTNMEGKEVRFGIFGSAMFATVTTDASCGAVNAMHDSLT
PLGGLVTLVNMQMGEVIFGGVGSGLYGMVLFILLTVFLAGLMVGRTPDYLGKRIEGREVT
LAMLALIIAATPPLLFSAVAAVSGWGQAALNNAGAHGFSEILYAYTSGVQNNGSAFAGLN
ANSPAWNVTIALAMLIGRFGIMLPMLGVAGSMASRKARPIGEFSFPVSGFTFGLLLTLVI
VIVGALTYLPALALGPVVEHFQMLDGLLH