Protein Info for DVU3338 in Desulfovibrio vulgaris Hildenborough JW710

Name: kdpB
Annotation: potassium-transporting ATPase, B subunit (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 678 transmembrane" amino acids 34 to 52 (19 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 247 to 272 (26 residues), see Phobius details amino acids 583 to 604 (22 residues), see Phobius details amino acids 612 to 631 (20 residues), see Phobius details amino acids 651 to 675 (25 residues), see Phobius details TIGR01497: K+-transporting ATPase, B subunit" amino acids 12 to 673 (662 residues), 995.5 bits, see alignment E=1.1e-303 TIGR01494: HAD ATPase, P-type, family IC" amino acids 70 to 337 (268 residues), 105.5 bits, see alignment E=2.3e-34 amino acids 368 to 600 (233 residues), 133.1 bits, see alignment E=1e-42 PF00122: E1-E2_ATPase" amino acids 105 to 279 (175 residues), 108.4 bits, see alignment E=4.8e-35 PF00702: Hydrolase" amino acids 296 to 525 (230 residues), 83.6 bits, see alignment E=3.8e-27

Best Hits

Swiss-Prot: 64% identical to KDPB_MYCTU: Potassium-transporting ATPase ATP-binding subunit (kdpB) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K01547, K+-transporting ATPase ATPase B chain [EC: 3.6.3.12] (inferred from 100% identity to dvl:Dvul_0054)

Predicted SEED Role

"Potassium-transporting ATPase B chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725T7 at UniProt or InterPro

Protein Sequence (678 amino acids)

>DVU3338 potassium-transporting ATPase, B subunit (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MHTANNTSTPSALYRRACIDAIGKLRPNHMVRNPVMFTVAVGALLTTVAFVRDMMAGSGV
LFSAQITLWLWATVLFANFAEALAEGRGKAQADSLRHARRDTPAHQVQPDGTVQVVSAST
LQRGDEVVVAAGMVIPADGTVIAGAAAVDESAVTGESAPVIRESGGDRSAVTGGTTVISD
TLRIKVTQEPGKSFLDRMIALVEGAERKKTPNEIALNILLAGLTLIFILATVTLKPMALF
HGARVDVVVLAALLVCLIPTTIGGLLAAIGIAGMDRLLRRNVLAMSGRAVEAAGDVDVLL
LDKTGTITLGNRMATAFIPMPGISPEHLCKAALLASHGDETPEGRSIVTLARTELGTGLP
AMPDNATFIPFRAETRMSGSDYTGTSIRKGAADAVKAWLRGLGRHMDETTLDTVVLDIAA
QGGTPLVVASDTEGVLGVIHLKDMVKPGISDRFERIRAMGIRTVMVTGDNRLTARSIAAE
AGVDDFLAEAKPEDKLDLIVRLQKEGRLVAMSGDGTNDAPALAQSDVGLVMNTGTQAARE
AGNMIDLDSDPTKLIEIVEIGKQLLITRGALTTFSVANDIAKYFAIIPAIFVASLPQLAA
LNVMGLSSPRSAVLSAVIFNALIIVALIPLALRGAHYRPRSTGATLRRNLLVYGLGGLVA
PFVGIKAIDILLTALGLA