Protein Info for DVU3313 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: transcriptional regulator, LysR family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 PF00126: HTH_1" amino acids 3 to 62 (60 residues), 90.3 bits, see alignment E=6.3e-30 PF03466: LysR_substrate" amino acids 87 to 290 (204 residues), 160.2 bits, see alignment E=4.7e-51

Best Hits

Swiss-Prot: 36% identical to XAPR_ECOLI: HTH-type transcriptional regulator XapR (xapR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to dvu:DVU3313)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725W2 at UniProt or InterPro

Protein Sequence (296 amino acids)

>DVU3313 transcriptional regulator, LysR family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MELRQLRYFVALAEELHFGRAARRVHVSQPPLSQQIRALEEELGARLFDRTSRRVLLTPE
GEAFLEDVRGVLRGLEEAVDRVRGVAQGERGRLRVGFVGSAVSTRFPAGVAAFRERHPAV
RLELRESGTLVQRRAIAEGRLDVGLFRNLGETPDDLTTEPFLHDSYILALPERHPLAGRD
SVNLADLRDVPLVMYPRPVFPAAYDAIIEACRSVGFSPRIGQEAVSIGTQKALVAAGTGV
AIVPGATRREPREGVAYRTIIGPLPDIRLDLAWRKGRDDALLRAFLDAVRPFGMEG