Protein Info for DVU3312 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: conserved hypothetical protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 PF10865: DUF2703" amino acids 4 to 120 (117 residues), 129.8 bits, see alignment E=2.7e-42

Best Hits

Swiss-Prot: 39% identical to Y1295_ARCFU: Uncharacterized protein AF_1295 (AF_1295) from Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

KEGG orthology group: None (inferred from 100% identity to dvu:DVU3312)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725W3 at UniProt or InterPro

Protein Sequence (151 amino acids)

>DVU3312 conserved hypothetical protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKSLPIVWQRLVDPEGNTCGRCGNTHESVLAAVEALKEILKPLDVAPILETREIDSESFR
VDPSQSNRIWIAGKPIEEWLDAKVSSSCCDTVCEGAHCRTLEIGDRTFEVIPPGMVIKAA
LIAASKMVDSAKRAGGCACDTGCCTHRHSPF