Protein Info for DVU3308 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: metallo-beta-lactamase family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 PF13483: Lactamase_B_3" amino acids 4 to 192 (189 residues), 89.1 bits, see alignment E=4.8e-29 PF00753: Lactamase_B" amino acids 15 to 94 (80 residues), 40.5 bits, see alignment E=4.5e-14 PF12706: Lactamase_B_2" amino acids 20 to 193 (174 residues), 109 bits, see alignment E=3.8e-35

Best Hits

Swiss-Prot: 100% identical to Y3308_DESVH: UPF0173 metal-dependent hydrolase DVU_3308 (DVU_3308) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: None (inferred from 99% identity to dvl:Dvul_0081)

Predicted SEED Role

"metallo-beta-lactamase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725W7 at UniProt or InterPro

Protein Sequence (239 amino acids)

>DVU3308 metallo-beta-lactamase family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQTRITWHGHSNFQVASGGTNVLIDPFFDGNPVAAARWDAIDRPDLVLVTHDHGDHVGQA
IDICKATGAKLGCVVGTDARLVEAGLPRELVLNGIGFNIGGTVECAGARITMTQAYHSSE
SGVPVGYIVTMPDGFTFYHAGDTGIFSEMELWGRLYAIDLALLPIGGVFTMDPRQAALAC
SLLRARSVIPMHWGTFPVLEQNTTRFREQLANHAPDCRLFNMTPGESLTLDRSQEGCAC