Protein Info for DVU3305 in Desulfovibrio vulgaris Hildenborough JW710

Name: atoC
Annotation: sigma-54 dependent transcriptional regulator/response regulator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 PF00072: Response_reg" amino acids 5 to 114 (110 residues), 103.2 bits, see alignment E=3.3e-33 PF14532: Sigma54_activ_2" amino acids 144 to 314 (171 residues), 62.7 bits, see alignment E=1.7e-20 PF00158: Sigma54_activat" amino acids 144 to 309 (166 residues), 225.8 bits, see alignment E=9.3e-71 PF01078: Mg_chelatase" amino acids 163 to 284 (122 residues), 22.2 bits, see alignment E=2.9e-08 PF07728: AAA_5" amino acids 167 to 287 (121 residues), 33.7 bits, see alignment E=1.2e-11 PF25601: AAA_lid_14" amino acids 316 to 393 (78 residues), 88.8 bits, see alignment E=6.1e-29 PF02954: HTH_8" amino acids 406 to 446 (41 residues), 49.2 bits, see alignment 1.3e-16

Best Hits

Swiss-Prot: 41% identical to DCTD_RHIME: C4-dicarboxylate transport transcriptional regulatory protein DctD (dctD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_0090)

Predicted SEED Role

"Response regulator of zinc sigma-54-dependent two-component system" in subsystem Zinc resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725X0 at UniProt or InterPro

Protein Sequence (451 amino acids)

>DVU3305 sigma-54 dependent transcriptional regulator/response regulator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTHRILVVDDEAIARDNLAILLRKRKYEVDTAANGEEAMRALAGADYDLVLTDLMMDDMD
GMALLRHIRQHHADTEVIMITGYATVETAVLAMQEGAYHYLAKPYRIEEARALVQKALEK
RALNQEVHRLREQLRERSLPVPILGSAPCIVELKRLIAKVAPAEASVLILGETGTGKELA
ARMVHLFSRRSDRRFLAINCGAFNDALLESELFGHEQGAFSGAARLKKGLFEAAEGGTLF
LDEVGEMSLAMQVKLLRTLQERSIRRVGGTVDIPVDVRLVAATNRDLKREAEAGTFRADL
FYRLNVVSLRMPPLSERRADIPLLARYFTEKSARDMQVAPPAIGQDALDALARYPFPGNV
RELQNIMERAVVLCSDGVIKAGHLPPDLFEAPDHVMRGDERKALTLDDNERDHIMWMLEH
AGGNRTLAARLLGIDRASLWRKLKRFGVEAG