Protein Info for DVU3299 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 120 to 138 (19 residues), see Phobius details amino acids 178 to 203 (26 residues), see Phobius details amino acids 209 to 236 (28 residues), see Phobius details amino acids 246 to 268 (23 residues), see Phobius details amino acids 277 to 299 (23 residues), see Phobius details amino acids 313 to 337 (25 residues), see Phobius details PF01925: TauE" amino acids 22 to 289 (268 residues), 126.2 bits, see alignment E=8.9e-41

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to dvl:Dvul_0095)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725X5 at UniProt or InterPro

Protein Sequence (356 amino acids)

>DVU3299 membrane protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MDILALDPSRFIELNAASVAFLFIVGFIGGLVSGFIGSGGAFVLTPGMMSLGVPGTVAVA
SNMCHKFPKALVGTIKRFKYGQVDLKLGLYMAISAAVGVQGGIRIQQMVLQTWGQAGSDL
YVSLSFVAVLVIVGGYVMQDAIRCARCHIPEGTPPLARRLQQIELPPMVTFKTSGIRISF
WFTVPVGLATGLLAATIAVGGFVGVPGMIYVLGVPGIMASATELVVAFIMGLGGSINWAM
HGLVDIRLVLIILGGSLLGVQLGAIGTTYVREHMIKVVMATIMLIVAVSRCIALPGYLVK
LGLMDLSASTLTILGRVSFVCMCFALFIGAVIILGSMWRGRAAERAGGVAGAHGQA