Protein Info for DVU3297 in Desulfovibrio vulgaris Hildenborough JW710

Name: mtr
Annotation: tryptophan-specific transport protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 17 to 38 (22 residues), see Phobius details amino acids 45 to 68 (24 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details amino acids 291 to 314 (24 residues), see Phobius details amino acids 349 to 372 (24 residues), see Phobius details amino acids 392 to 416 (25 residues), see Phobius details PF03222: Trp_Tyr_perm" amino acids 16 to 407 (392 residues), 411.3 bits, see alignment E=2.4e-127 TIGR00837: aromatic amino acid transport protein" amino acids 20 to 400 (381 residues), 415.8 bits, see alignment E=1.1e-128

Best Hits

KEGG orthology group: K03835, tryptophan-specific transport protein (inferred from 100% identity to dvu:DVU3297)

Predicted SEED Role

"Tryptophan-specific transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725X7 at UniProt or InterPro

Protein Sequence (419 amino acids)

>DVU3297 tryptophan-specific transport protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQNAAHRPGQNAAHRPGVFGGTMIIAGTSIGAGMLALPTISAGMWFGWSLAVMLLAWLVM
LLSSQALLEVNLHFEPGASFHTLVRETLGPGWSVINGAAVAFVLYILVYAYVSGGGSIMR
HTLLAVSGYEPSKLAAGLSFALLLAACVWWSTWIVDRLSVIMMGGMVVSFILSMSGMLSD
IRADVLFDAGGEGGSALFVWGALSTYLTSFCFHASVPSLVKYFGRRPADINRCLVGGTGI
ALVCYLLWIVACDGTIPRAEFRDVIAAGGNVGDLVRAAGSNLNSGFILRMLEAFSALAVA
TSFLGAGLGLFDYIADLCRFDDTRAGRTKTTLVTFGPPTVGGLLWPDGFLLAIGWAGLAA
TVWSVVVPALMLRASRATRPAPGYRVGGGSLTVPALLAFGLVTAVCHTLFVFGVLPMYR