Protein Info for DVU3295 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: hemolysin III (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 39 to 61 (23 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details PF03006: HlyIII" amino acids 6 to 205 (200 residues), 174.7 bits, see alignment E=1.2e-55 TIGR01065: channel protein, hemolysin III family" amino acids 7 to 212 (206 residues), 210.5 bits, see alignment E=9.3e-67

Best Hits

KEGG orthology group: K11068, hemolysin III (inferred from 100% identity to dvl:Dvul_0099)

Predicted SEED Role

"COG1272: Predicted membrane protein hemolysin III homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725X9 at UniProt or InterPro

Protein Sequence (215 amino acids)

>DVU3295 hemolysin III (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAVRLREPVNGLTHCLGAVLALVGAVLLLARVASPAMPWHIVTFAVFGTAMVMLYTASTL
YHWLPLSEAGVRLWRRIDHCMIFVYIAATYTPICLIPLRGPWGWSLFGSVWALALAGIFV
KVFWLHAPRWLSTGLYLGMGWMVIVGVYPLVVSLPAGALWWLLAGGLFYTVGAVVYASRW
PNVARHFGFHELFHVFVMAGSFCHFLVMYLYVSRL