Protein Info for DVU3272 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: TPR domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 PF13432: TPR_16" amino acids 13 to 57 (45 residues), 20.2 bits, see alignment 4.1e-07 amino acids 30 to 89 (60 residues), 24.5 bits, see alignment E=1.8e-08 PF00515: TPR_1" amino acids 95 to 126 (32 residues), 28.2 bits, see alignment 7.2e-10 PF13181: TPR_8" amino acids 96 to 126 (31 residues), 23.3 bits, see alignment 3e-08 amino acids 163 to 189 (27 residues), 17.8 bits, see alignment (E = 1.7e-06) PF07719: TPR_2" amino acids 96 to 126 (31 residues), 27.7 bits, see alignment 1.2e-09 PF13374: TPR_10" amino acids 164 to 189 (26 residues), 16.2 bits, see alignment (E = 5.3e-06)

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU3272)

Predicted SEED Role

"TPR domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726A1 at UniProt or InterPro

Protein Sequence (207 amino acids)

>DVU3272 TPR domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKARYEDLDEYIADLRAEIAQSENCANHHYNLGLALLSKRDFVAAEESFLNAVRNSPRLA
EAYVQLGGICLQRGDLEGCLRYNEEAAQSRPKFPVAWSNIGFVHLQRGEPEKAIAALKKA
LKWQPDFIQAMATMGAAFYMEGDYEACINISNEAIKKEPSFGPAYNNLALAYFELGDFAK
SVKFADLAMENGFEVRPEFLKELEAHR