Protein Info for DVU3270 in Desulfovibrio vulgaris Hildenborough JW710

Name: cydB
Annotation: cytochrome d ubiquinol oxidase, subunit II (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 transmembrane" amino acids 6 to 34 (29 residues), see Phobius details amino acids 56 to 70 (15 residues), see Phobius details amino acids 73 to 98 (26 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details amino acids 228 to 247 (20 residues), see Phobius details amino acids 254 to 275 (22 residues), see Phobius details amino acids 302 to 323 (22 residues), see Phobius details TIGR00203: cytochrome d ubiquinol oxidase, subunit II" amino acids 2 to 217 (216 residues), 231.9 bits, see alignment E=7e-73 PF02322: Cyt_bd_oxida_II" amino acids 2 to 326 (325 residues), 349.7 bits, see alignment E=7.4e-109

Best Hits

KEGG orthology group: K00426, cytochrome bd-I oxidase subunit II [EC: 1.10.3.-] (inferred from 100% identity to dvl:Dvul_0119)

Predicted SEED Role

"Cytochrome d ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases (EC 1.10.3.-)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726A3 at UniProt or InterPro

Protein Sequence (341 amino acids)

>DVU3270 cytochrome d ubiquinol oxidase, subunit II (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLETIWFVLWGLLWAVYFVLDGFDLGMGTLLPFVTRNEVERRTLYNSAGPFWDGNEVWLI
TAGGVTFAAFPKAYAVMFSALYAPLLMLLFALIMRAVSFEFRNKVDSPGWRKLWDVFQFL
GNFVPALLFGVAFANLFMGIPIDKDGVYHGNLLLLLNPYGLAGGVFFVLMFSLHGALWLA
IKSQGDLHARAVRTAKALWPYLVGVAVLFLAMTAAYTTLWSNYAKVPPLMIFPVLAVASL
LTIRFLLSSDSVVLAWVFSALFIISVTFFGVLGMFPNLLPSSMDPAAHVSIYNGASSPLT
LKIMLGVVAIFVPIVIAYQAWVYSVFSHKVTDEDLKMDNAY