Protein Info for DVU3269 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sensory box histidine kinase/response regulator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 839 transmembrane" amino acids 19 to 39 (21 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 52 to 175 (124 residues), 30 bits, see alignment E=2.4e-11 amino acids 177 to 303 (127 residues), 29.7 bits, see alignment E=3e-11 PF00989: PAS" amino acids 61 to 154 (94 residues), 23.5 bits, see alignment E=1.4e-08 PF08448: PAS_4" amino acids 62 to 169 (108 residues), 33.3 bits, see alignment E=1.5e-11 amino acids 187 to 298 (112 residues), 38.8 bits, see alignment E=2.9e-13 PF00512: HisKA" amino acids 436 to 501 (66 residues), 71.7 bits, see alignment 1.3e-23 PF02518: HATPase_c" amino acids 548 to 661 (114 residues), 83.8 bits, see alignment E=3.6e-27 PF00072: Response_reg" amino acids 712 to 826 (115 residues), 92.4 bits, see alignment E=6.2e-30

Best Hits

KEGG orthology group: K00936, [EC: 2.7.3.-] (inferred from 100% identity to dvu:DVU3269)

Predicted SEED Role

"Sensory box histidine kinase/response regulator"

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726A4 at UniProt or InterPro

Protein Sequence (839 amino acids)

>DVU3269 sensory box histidine kinase/response regulator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAVSPDGPMSLYGLLAPHLPALVPAVLLACLCVCIVLIARLRRQVGAARHENDLLKAMRI
ASPVPLCVKDVHGRYLGCNHAFELLFGVREADILGGTAAGVLPQPLAAGESAAEENMARF
GTSRQTFMSAYESPGGPALVLQVDCATWRDASGVHKGQVNAYADITPLKRAEAALHESEA
RNRMLVEEAPISIMSFDAAGHITFVNKWHLRVFCRHRVDAGFFIGRRLDALPGLARAGLC
ERVARVLHGEELAIREVYFPEFTGGHDGWASIRGVPIHRDGQIVGGILIREDITERKRME
EVLRQREALVSSMLRNLPIDFWAADGEGRMLMQSDESVRVWGHLPSGVEPLTGSPLQWRN
SDRFEPRVFAGETVEREIDVALPSGQMRTFNVIAAPVRLQGGITAMLRVNLDVTERKRVL
AELRTARDAAEAANKAKSEFLAHMSHELRTPLNGVMGMLQLLDEHVAAPQGRAWLDVALE
SSRALLRILSDILDLSRIEAGRLDLMQEPFTPESVLAPVLVSLHRTVEGRAVRIVNEMDD
SMPPVLVGDPGRIRQVLLNLLGNAAKYTERGEVRVGMRVLRRNGKALRVHLHVTDTGVGI
ADEQLQRALEPFGRLRQGSGLPRGVGLGLPIVVRLVRLMGGTLCIASEQGVGTEVHVTLP
LLEADAGAVPVAPDVDEAGGICSFAAFRCAGVVPEADRLAPGEAPSPAVRHVLLVEDDPV
NLMAARRMLERLECKVTTATCGQEALNALRSSVFDAVFMDIQMPDFDGIEALRRMRAKGS
GVLRPQTPVVAMTAFAMKGDRERFMTEGMADYVSKPVLISALKDVLERLAVTSPGTSRT