Protein Info for DVU3265 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: tartrate dehydratase beta subunit, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05683: Fumerase_C
  • amino acids 6 to 175 (170 residues), 177.2 bits, E=1.4e-56
• TIGR00723: hydrolyase, tartrate beta subunit/fumarate domain protein, Fe-S type
  • amino acids 15 to 174 (160 residues), 168.3 bits, E=7.2e-54

Best Hits

KEGG orthology group: K01678, fumarate hydratase subunit beta [EC: 4.2.1.2] (inferred from 100% identity to dvu:DVU3265)

Predicted SEED Role

"Fumarate hydratase class I, aerobic (EC 4.2.1.2)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 4.2.1.2)

MetaCyc Pathways

• reductive TCA cycle I (9/11 steps found)
• incomplete reductive TCA cycle (6/7 steps found)
• TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
• TCA cycle VI (Helicobacter) (7/9 steps found)
• mixed acid fermentation (12/16 steps found)
• TCA cycle VII (acetate-producers) (6/9 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (18/26 steps found)
• partial TCA cycle (obligate autotrophs) (5/8 steps found)
• TCA cycle I (prokaryotic) (6/10 steps found)
• TCA cycle III (animals) (6/10 steps found)
• TCA cycle VIII (Chlamydia) (3/6 steps found)
• TCA cycle II (plants and fungi) (5/9 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (5/9 steps found)
• reductive TCA cycle II (7/12 steps found)
• superpathway of glyoxylate bypass and TCA (7/12 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (14/22 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)
• pyruvate fermentation to propanoate I (2/7 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (5/14 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (2/10 steps found)
• L-glutamate degradation VIII (to propanoate) (2/11 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (6/17 steps found)
• methylaspartate cycle (6/19 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (22/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.2

Use Curated BLAST to search for 4.2.1.2

Sequence Analysis Tools

See Q726A8 at UniProt or InterPro

Protein Sequence (183 amino acids)

>DVU3265 tartrate dehydratase beta subunit, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPVHHLTTPLTDTAVDALRSGDVILLSGTIYTARDAAHRRLCDALDRGEQPPFDLRGAVI
YYVGPSPAPPGHPIGAAGPTTSYRMDSYAPRLHALGLKATIGKGRRHATVRKALSEHTAV
YFGATGGAGALLAQRITAARVIAYDDLGPEAIRELTVQDFPLLVINDAHGGELYVTPQLP
EGD