Protein Info for DVU3247 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: efflux transporter, RND family, MFP subunit (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 42 to 373 (332 residues), 285.1 bits, see alignment E=3e-89 PF25917: BSH_RND" amino acids 66 to 207 (142 residues), 50.5 bits, see alignment E=3.9e-17 PF25876: HH_MFP_RND" amino acids 106 to 175 (70 residues), 30.7 bits, see alignment E=7.9e-11 PF25944: Beta-barrel_RND" amino acids 213 to 300 (88 residues), 47.5 bits, see alignment E=5.1e-16 PF25954: Beta-barrel_RND_2" amino acids 243 to 298 (56 residues), 28.8 bits, see alignment 2.9e-10 PF25967: RND-MFP_C" amino acids 305 to 365 (61 residues), 42.7 bits, see alignment E=1.1e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU3247)

Predicted SEED Role

"Membrane fusion protein of RND family multidrug efflux pump" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725M2 at UniProt or InterPro

Protein Sequence (389 amino acids)

>DVU3247 efflux transporter, RND family, MFP subunit (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLRRHTISRAVHIALLALATATGIYGCDSRNAYVPPPPPKVTVGAPHVGPVTEYMEFSGT
IAAVESVDITARVTGTLRSAQFRDGSTVHKGDPLFIIEPEPYQAALQRAEAELEVQQAAL
ARAETELARSRKLLTEKAGSETDVVKWQQQRDSAKANISRAKAQIETARIDLGYTRITAP
FDGQISRRFADPGNVVGPGAVTRLATIVRRDQVHVYFNINERDLLRLMAERPKPKTASAP
TMPLELALADEDGFPHAGKLDYADPGVDPATGTMQLRGLFPNPSGRLLPGLFARIRVAVG
QSDKAMMVPDRAIGQDQSGSYVIIVNAQNIAEQRAVVLGPLHEGYRVVSKGLSAEDRVVV
NGIQRARPGSPVDPTPAPDTGQPAGKPAS