Protein Info for DVU3236 in Desulfovibrio vulgaris Hildenborough JW710

Name: hflX
Annotation: GTP-binding protein HflX (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 TIGR03156: GTP-binding protein HflX" amino acids 143 to 491 (349 residues), 461.3 bits, see alignment E=9.1e-143 PF13167: GTP-bdg_N" amino acids 159 to 245 (87 residues), 106.3 bits, see alignment E=2e-34 PF16360: GTP-bdg_M" amino acids 247 to 325 (79 residues), 101.8 bits, see alignment E=5.1e-33 PF02421: FeoB_N" amino acids 334 to 458 (125 residues), 29 bits, see alignment E=1.5e-10 PF01926: MMR_HSR1" amino acids 334 to 451 (118 residues), 78.6 bits, see alignment E=7.8e-26

Best Hits

KEGG orthology group: K03665, GTP-binding protein HflX (inferred from 100% identity to dvu:DVU3236)

Predicted SEED Role

"GTP-binding protein HflX" in subsystem Hfl operon or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725J4 at UniProt or InterPro

Protein Sequence (547 amino acids)

>DVU3236 GTP-binding protein HflX (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MGRQLGLLIDRQGRVEMIIVGDTGAIFIPELPRARSGAGRLRGLRLVHTHLTPELISQED
LMDLLFLRLDGLAVLTVDAHGGPQQLQRAHLLPPNPEKRHYTVHPATPWDRVETDFVAEV
EALEEEMTRAMPEVREASDGPAAVLVSVAALPRPVQELNLEELRELARTAGVDVVGTMIQ
RVPSVNPKFILGKGKLTELEVLALQGNASMIVFDGELSPAQLRNIAEVTERKVLDRTQLI
LDIFAQHATTRAGKLQVEMAQLKYTQPRLVGKNRAMDRLAGGIGGRGPGETKLETDRRRI
RDRITRIKGELDTLRKQRAFARARRAKQRVPLASLVGYTNAGKSTLLNALTNAEVLAENK
LFATLDPTTRRLRFPEERELILADTVGFIRNLPKELVEAFRATLEELEAADLLIHVADAG
HPELDRQLRAVEDILVEMEMHDIPRLLVLNKWDTVPEELRETLLLAHPEAIPVAALQREG
LDALAHGIASRIDWERTMRPADGTDGEWCDEGTDASPSGTVDPDAWGSDTDDGLPYEWPC
SCEDPVQ