Protein Info for DVU3229 in Desulfovibrio vulgaris Hildenborough JW710

Name: fliA
Annotation: RNA polymerase sigma factor for flagellar operon FliA (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 37 to 254 (218 residues), 108.9 bits, see alignment E=2.1e-35 PF04542: Sigma70_r2" amino acids 39 to 111 (73 residues), 49.5 bits, see alignment E=5.7e-17 TIGR02479: RNA polymerase sigma factor, FliA/WhiG family" amino acids 39 to 255 (217 residues), 263.3 bits, see alignment E=1.9e-82 PF08281: Sigma70_r4_2" amino acids 199 to 251 (53 residues), 34.2 bits, see alignment E=3.1e-12 PF04545: Sigma70_r4" amino acids 205 to 252 (48 residues), 59.8 bits, see alignment 2.9e-20

Best Hits

Swiss-Prot: 41% identical to FLIA_YEREN: RNA polymerase sigma factor FliA (fliA) from Yersinia enterocolitica

KEGG orthology group: K02405, RNA polymerase sigma factor for flagellar operon FliA (inferred from 100% identity to dvl:Dvul_0159)

Predicted SEED Role

"RNA polymerase sigma factor for flagellar operon" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726C4 at UniProt or InterPro

Protein Sequence (265 amino acids)

>DVU3229 RNA polymerase sigma factor for flagellar operon FliA (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MVTSSSSGKSCSSAASPWEALEAGTTAWPDFAPAEKEAIVRHYAPKIRFLALRLKAKLPR
NVELGELISAGTLGLMEALGKFKPQLGIRFETYAESRIRGAMLDELRRLDWFPRSLRQRV
RQLDEAMQRIEHETGRRATEEDLQKATGLDEKDVRLGLEALQNQLCLSLEAMQDSLAGEG
GPQSDADPMQTAATQELIERVASLIDELTPREKLVLSLYYSDELNMRETAEVMGITEGRV
SQLHSQALGRLRREFRNHYGEHDAV