Protein Info for DVU3224 in Desulfovibrio vulgaris Hildenborough JW710

Name: sfsA
Annotation: sugar fermentation stimulation protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 TIGR00230: sugar fermentation stimulation protein" amino acids 13 to 227 (215 residues), 186.6 bits, see alignment E=2.3e-59 PF17746: SfsA_N" amino acids 18 to 88 (71 residues), 60.1 bits, see alignment E=1.9e-20 PF03749: SfsA" amino acids 92 to 227 (136 residues), 144.9 bits, see alignment E=1.4e-46

Best Hits

Swiss-Prot: 100% identical to SFSA_DESVH: Sugar fermentation stimulation protein homolog (sfsA) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K06206, sugar fermentation stimulation protein A (inferred from 100% identity to dvu:DVU3224)

Predicted SEED Role

"Sugar/maltose fermentation stimulation protein homolog" in subsystem Fermentations: Mixed acid

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P61663 at UniProt or InterPro

Protein Sequence (242 amino acids)

>DVU3224 sugar fermentation stimulation protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRKILLPYPAGCATGTFVRRVKRFSVEMTRDGESVWVHSNNSGSMLGLLRPGATMLASPA
ANPDRKLAWTHEAMRCHGDGPQGFWVGVNTSVPNRMVEAAFHAGRLPWAQGYDTFRRERK
RGDSRLDARLDGPGLPTLWVECKNVTMVEDDVACFPDAVTERGSKHLREMMDIVSRGERA
AMFYLVQRPDGLCFGPADVIDPQYAALFWEAVDAGVEMYPHRGIVSPVGIDLSGVLPLTR
CR