Protein Info for DVU3222 in Desulfovibrio vulgaris Hildenborough JW710
Name: pgi
Annotation: glucose-6-phosphate isomerase (TIGR)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K01810, glucose-6-phosphate isomerase [EC: 5.3.1.9] (inferred from 100% identity to dvl:Dvul_0166)Predicted SEED Role
"Glucose-6-phosphate isomerase (EC 5.3.1.9)" in subsystem Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 5.3.1.9)
MetaCyc Pathways
- homolactic fermentation (11/12 steps found)
- Bifidobacterium shunt (13/15 steps found)
- O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
- colanic acid building blocks biosynthesis (10/11 steps found)
- glycolysis III (from glucose) (10/11 steps found)
- glycolysis I (from glucose 6-phosphate) (11/13 steps found)
- UDP-N-acetyl-D-glucosamine biosynthesis I (5/5 steps found)
- superpathway of anaerobic sucrose degradation (15/19 steps found)
- gluconeogenesis I (10/13 steps found)
- sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
- gluconeogenesis III (9/12 steps found)
- sucrose biosynthesis II (6/8 steps found)
- GDP-mannose biosynthesis (3/4 steps found)
- heterolactic fermentation (13/18 steps found)
- glycolysis V (Pyrococcus) (7/10 steps found)
- superpathway of glycolysis and the Entner-Doudoroff pathway (12/17 steps found)
- UDP-N-acetyl-D-glucosamine biosynthesis II (4/6 steps found)
- sucrose degradation II (sucrose synthase) (3/5 steps found)
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (18/26 steps found)
- sucrose degradation III (sucrose invertase) (2/4 steps found)
- sucrose degradation IV (sucrose phosphorylase) (2/4 steps found)
- UDP-N-acetyl-D-galactosamine biosynthesis II (4/7 steps found)
- D-sorbitol biosynthesis I (1/3 steps found)
- sucrose biosynthesis III (1/3 steps found)
- chitin biosynthesis (5/9 steps found)
- 1,5-anhydrofructose degradation (2/5 steps found)
- superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (8/14 steps found)
- starch biosynthesis (5/10 steps found)
- UDP-N-acetyl-D-galactosamine biosynthesis III (2/6 steps found)
- formaldehyde oxidation I (2/6 steps found)
- 1,3-propanediol biosynthesis (engineered) (4/9 steps found)
- gluconeogenesis II (Methanobacterium thermoautotrophicum) (9/18 steps found)
- superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (7/24 steps found)
- superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (22/56 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Glycolysis / Gluconeogenesis
- Pentose phosphate pathway
- Starch and sucrose metabolism
Isozymes
No predicted isozymesUse Curated BLAST to search for 5.3.1.9
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q725H4 at UniProt or InterPro
Protein Sequence (447 amino acids)
>DVU3222 glucose-6-phosphate isomerase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710) MPAMHRLDWTNAWTGRLEGQQEAPFALRHADIAHRFATELSAGRLPFVDMPYAEDLIASL EALTPRLRRFRHMVLLGIGGSALGARALQKAFHPSQDRPGHTGPCLWIADNIDADTLEAW FATLPARETIVVAVSKSGGTIETVAQYLLAREWLRGHLGESWRENMLLVTDVAHGFMRQE ADTHGLVSLPVPDHLGGRYSVLSAVGLVPAAFLGMDWRALLDGALSVGRPLRDGGLPADH PAWRLALWNRSLMAHGYTQIIFFAYIPLWATFGPWFAQLWAESLGKEGKGSMPLPATGVT DQHSLQQMFLDGPRDKGCLFLTCPTLPAGRAFPLQLPDQWAFLKGAHFGDLLHAEALGTR MALASCDVPTVALEMADTGPEAAGRMMALLELATLFTGWLLDINPLDQPAVELGKRLANA KLGAPGYEAEGSALAGFLAREGERQEF