Protein Info for DVU3222 in Desulfovibrio vulgaris Hildenborough JW710

Name: pgi
Annotation: glucose-6-phosphate isomerase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 70 to 88 (19 residues), see Phobius details amino acids 199 to 219 (21 residues), see Phobius details amino acids 256 to 280 (25 residues), see Phobius details PF00342: PGI" amino acids 69 to 287 (219 residues), 70.5 bits, see alignment E=6e-24 amino acids 367 to 420 (54 residues), 23.4 bits, see alignment 1.1e-09

Best Hits

KEGG orthology group: K01810, glucose-6-phosphate isomerase [EC: 5.3.1.9] (inferred from 100% identity to dvl:Dvul_0166)

Predicted SEED Role

"Glucose-6-phosphate isomerase (EC 5.3.1.9)" in subsystem Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 5.3.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725H4 at UniProt or InterPro

Protein Sequence (447 amino acids)

>DVU3222 glucose-6-phosphate isomerase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPAMHRLDWTNAWTGRLEGQQEAPFALRHADIAHRFATELSAGRLPFVDMPYAEDLIASL
EALTPRLRRFRHMVLLGIGGSALGARALQKAFHPSQDRPGHTGPCLWIADNIDADTLEAW
FATLPARETIVVAVSKSGGTIETVAQYLLAREWLRGHLGESWRENMLLVTDVAHGFMRQE
ADTHGLVSLPVPDHLGGRYSVLSAVGLVPAAFLGMDWRALLDGALSVGRPLRDGGLPADH
PAWRLALWNRSLMAHGYTQIIFFAYIPLWATFGPWFAQLWAESLGKEGKGSMPLPATGVT
DQHSLQQMFLDGPRDKGCLFLTCPTLPAGRAFPLQLPDQWAFLKGAHFGDLLHAEALGTR
MALASCDVPTVALEMADTGPEAAGRMMALLELATLFTGWLLDINPLDQPAVELGKRLANA
KLGAPGYEAEGSALAGFLAREGERQEF