Protein Info for DVU3220 in Desulfovibrio vulgaris Hildenborough JW710

Name: atoC
Annotation: sigma-54 dependent transcriptional regulator/response regulator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 PF00072: Response_reg" amino acids 7 to 116 (110 residues), 98.2 bits, see alignment E=9.6e-32 PF00158: Sigma54_activat" amino acids 145 to 311 (167 residues), 243.2 bits, see alignment E=3.6e-76 PF14532: Sigma54_activ_2" amino acids 146 to 316 (171 residues), 82.9 bits, see alignment E=8.1e-27 PF07728: AAA_5" amino acids 169 to 288 (120 residues), 38.1 bits, see alignment E=4.4e-13 PF02954: HTH_8" amino acids 413 to 454 (42 residues), 39.5 bits, see alignment 1.1e-13

Best Hits

KEGG orthology group: K02481, two-component system, NtrC family, response regulator (inferred from 100% identity to dvl:Dvul_0168)

Predicted SEED Role

"Nitrogen regulation protein NtrX"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725H6 at UniProt or InterPro

Protein Sequence (459 amino acids)

>DVU3220 sigma-54 dependent transcriptional regulator/response regulator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSETTHILVIDDEKNYLLVLEALLTDAGYAVTALNDPETALAFLEESEVDVVITDMKMPR
VTGREVLERVKKTWPHIPVCIMTAFGSIEGAVDVMKYGAFDYITKPFSNDELLLSVQNAA
ELSRVHRQYRALRANLEERYGTHQIIGRSKAIREVLDMVDRAAPSRSTVLITGESGTGKE
LVARAIHFSSPRNSGPFVSVNCMALNPGVLESELFGHEKGSFTGAMAMRRGRFEQADGGT
LFLDEIGELTPELQVKLLRVLQERRFERVGGGDEIEVDIRVVAATNKDLQKEVENGTFRE
DLYYRLNVVHVALPPLRERREDIPLLVGHFVEKLARDNGMKPKTFTPEAHDYLTGYEWPG
NIRQLQNVVERCLVLVASDTVGVDDLPPEIRDEESQLKSAVDLLPVRLDLADTLEKIEAA
LIRRALVRAEFVQVKAAELLGISKSLLQYKLKKYGITGH