Protein Info for DVU3188 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: NLP/P60 family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 transmembrane" amino acids 75 to 93 (19 residues), see Phobius details PF00877: NLPC_P60" amino acids 128 to 235 (108 residues), 83 bits, see alignment E=6.9e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU3188)

Predicted SEED Role

"NLP/P60 family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725K6 at UniProt or InterPro

Protein Sequence (239 amino acids)

>DVU3188 NLP/P60 family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSSMTTPHTSASRDHAARCGRDGGAAFPRCALPRAFARFFPCIAHGSEMSVSPSGTSSVR
PSGWPFAGLRSRPRAVRILFGLVLGFVLLAGGCAERQVLVLPEPAQTGPPPASDTARSVV
ATARGQLGVPYRAGGLDPRSGFDCSGFIWWTYHQNGINLPRTTAEQATAGAAVPGNVLRP
ADILVFRTGSGMHGLHTGIYTGNGRFVHSPKPGATVREETLDIPYWRRNFIAARRVVWP