Protein Info for DVU3183 in Desulfovibrio vulgaris Hildenborough JW710

Name: rbO
Annotation: desulfoferrodoxin (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 TIGR00320: desulfoferrodoxin" amino acids 1 to 125 (125 residues), 241.9 bits, see alignment E=2e-76 TIGR00319: desulfoferrodoxin FeS4 iron-binding domain" amino acids 1 to 34 (34 residues), 78.2 bits, see alignment E=4e-26 PF06397: Desulfoferrod_N" amino acids 2 to 37 (36 residues), 72.4 bits, see alignment E=1.8e-24 TIGR00332: desulfoferrodoxin ferrous iron-binding domain" amino acids 41 to 125 (85 residues), 88.3 bits, see alignment E=6.1e-29 PF01880: Desulfoferrodox" amino acids 42 to 124 (83 residues), 77.5 bits, see alignment E=1e-25

Best Hits

Swiss-Prot: 100% identical to DFX_DESVH: Desulfoferrodoxin (dfx) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K05919, superoxide reductase [EC: 1.15.1.2] (inferred from 100% identity to dvu:DVU3183)

Predicted SEED Role

"Superoxide reductase (EC 1.15.1.2)" in subsystem Oxidative stress or Rubrerythrin (EC 1.15.1.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.15.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P20418 at UniProt or InterPro

Protein Sequence (126 amino acids)

>DVU3183 desulfoferrodoxin (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPNQYEIYKCIHCGNIVEVLHAGGGDLVCCGEPMKLMKEGTSDGAKEKHVPVIEKTANGY
KVTVGSVAHPMEEKHWIEWIELVADGVSYKKFLKPGDAPEAEFCIKADKVVAREYCNLHG
HWKAEA