Protein Info for DVU3174 in Desulfovibrio vulgaris Hildenborough JW710

Name: ubiE
Annotation: ubiquinone/menaquinone biosynthesis methlytransferase UbiE (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF01209: Ubie_methyltran" amino acids 31 to 256 (226 residues), 168.3 bits, see alignment E=2.8e-53 TIGR01934: ubiquinone/menaquinone biosynthesis methyltransferase" amino acids 33 to 256 (224 residues), 215.3 bits, see alignment E=3.5e-68 PF13649: Methyltransf_25" amino acids 75 to 170 (96 residues), 48.5 bits, see alignment E=1.8e-16 PF08241: Methyltransf_11" amino acids 76 to 173 (98 residues), 45.2 bits, see alignment E=1.8e-15

Best Hits

Swiss-Prot: 38% identical to UBIE_PARDP: Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (ubiE) from Paracoccus denitrificans (strain Pd 1222)

KEGG orthology group: K03183, ubiquinone/menaquinone biosynthesis methyltransferase [EC: 2.1.1.- 2.1.1.163] (inferred from 100% identity to dvl:Dvul_0212)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.163

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q725J9 at UniProt or InterPro

Protein Sequence (258 amino acids)

>DVU3174 ubiquinone/menaquinone biosynthesis methlytransferase UbiE (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSTSEDTLRTSPDTFDADSVTSKGAPQEHARQVSGMFGRIARWYDLLNHVLSGGLDLYWR
YRLVRQVVPGPTGRVLDLAAGTLDVAREIHRQHPGMRVPALDFCEAMLRAGQPKLVDGVQ
DVIWPAVADGRRLPLADASVDCVTIAFGIRNIVPRREAFEEMLRVLVPGGRACILEFGTG
KTPVWKGLYNFYLNTLLPLVGRCVSGDAGAYRYLADTIMSFPDADALAAEMHDAGFTRVY
HLPLTSGIVRLHVGEKPL