Protein Info for DVU3169 in Desulfovibrio vulgaris Hildenborough JW710

Name: cbiG
Annotation: cobalamin biosynthesis protein CbiG (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF11760: CbiG_N
  • amino acids 50 to 130 (81 residues), 112.9 bits, E=8.4e-37
• PF11761: CbiG_mid
  • amino acids 135 to 273 (139 residues), 55 bits, E=1.2e-18
• PF01890: CbiG_C
  • amino acids 276 to 395 (120 residues), 99.3 bits, E=3.2e-32

Best Hits

KEGG orthology group: K02189, cobalamin biosynthesis protein CbiG (inferred from 100% identity to dvu:DVU3169)

Predicted SEED Role

"Cobalamin biosynthesis protein CbiG" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

• adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)
• cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (13/15 steps found)

Sequence Analysis Tools

See Q725I0 at UniProt or InterPro

Protein Sequence (398 amino acids)

>DVU3169 cobalamin biosynthesis protein CbiG (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MEPSDIACHALTPQGADLARRIATALHGTVYLPRRFAQDGEHAFDALAPHLAATFRAHSG
HVFIAAAGIVVRGLAPLLGRKDTDPAVVVCDQHGAYAISLLSGHLGGANDLARHVAHITG
GHAVITTATDTAGLPSLDMAARDAGCAIRNLGAVKAINGALLEGRPVMLFDPQDRLGLAR
HVAGQDAAGDENAKASRTDEDSAAHDDRPDGGPTTGVDDADAAPATRVSASHAPLFRCVA
DLDTLLALPHDVACVAVTWRDIPGTRSRLVLHPPVIHAGIGCRRGAGVEAVARLLDEALR
MAGAASHSLAALHTVDIKGDEPALHAVAAARDVRLHCHAAASLAAIEVPNPTPKAAEVLG
TGPVGVCEAAAILGSGGGRLLVEKMKGDGVTVALALRP