Protein Info for DVU3150 in Desulfovibrio vulgaris Hildenborough JW710

Name: rpsA
Annotation: ribosomal protein S1 (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 577 TIGR00717: ribosomal protein bS1" amino acids 30 to 482 (453 residues), 593.1 bits, see alignment E=2.2e-182 PF00575: S1" amino acids 119 to 187 (69 residues), 40.8 bits, see alignment E=7.1e-14 amino acids 205 to 276 (72 residues), 65.3 bits, see alignment E=1.6e-21 amino acids 290 to 363 (74 residues), 74.9 bits, see alignment E=1.6e-24 amino acids 377 to 449 (73 residues), 64.3 bits, see alignment E=3.4e-21 amino acids 465 to 536 (72 residues), 72.7 bits, see alignment E=8e-24 PF23459: S1_RRP5" amino acids 292 to 360 (69 residues), 33.1 bits, see alignment E=2e-11 amino acids 379 to 446 (68 residues), 33.2 bits, see alignment E=1.9e-11 amino acids 467 to 534 (68 residues), 32 bits, see alignment E=4.7e-11

Best Hits

Swiss-Prot: 48% identical to RS1_PSEAE: 30S ribosomal protein S1 (rpsA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02945, small subunit ribosomal protein S1 (inferred from 100% identity to dvu:DVU3150)

Predicted SEED Role

"SSU ribosomal protein S1p" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726F8 at UniProt or InterPro

Protein Sequence (577 amino acids)

>DVU3150 ribosomal protein S1 (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MATTPETMENHAFDADMSFESALENYLSSDFGDLEEGSIVKGEIVRLGDDYVLVDVNFKS
EGQIAANEFRDANGDLIIGVGDRVDVFVVRKNEMEGTITLSYEKAKRMQLFDQLEEVQEK
NGVIKGRIVRRIKGGYTVDLGGVEAFLPGSHVDLRPVPDMDALVNQEYEFRVLKINRRRS
NVIVSRRVLLEEERDSKRQDLLRTLEEGQVVKGKAKNITEYGVFVDLGGLDGLLHITDMS
WKRIRHPKELVSLGQELELKVLSFDRDSQKVSLGMKQLVADPWQDITAKFPEGLRGQGKV
TNLVDYGAFVELEPGVEGLVHISEMSWTRKLRHPSQMVRVGDEVEVVILGVDPDKKRISL
GMKQVKPNPWEVVAEKYPEGTILEGVIKNITEFGMFIGIEDGIDGLIHVSDISWTKKIRH
PNEMYKVGDVVQAKVLTVDQENEKFTLGVKQLAEDPWSRVPATYPVGTLVTGSVTNITDF
GLFVEVEEGIEGLVHVSEISQKKIKSPSEIYKEGQEIQAKVIHVSAEERRLGLSIKQLKD
EEERRKPKEFRSGSPEVGGQTLGDILKLKLEEDAADN