Protein Info for DVU3145 in Desulfovibrio vulgaris Hildenborough JW710

Name: b1670
Annotation: hydrogenase, b-type cytochrome subunit, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 47 to 70 (24 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 117 to 140 (24 residues), see Phobius details amino acids 150 to 177 (28 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 9 to 195 (187 residues), 114 bits, see alignment E=3.6e-37

Best Hits

KEGG orthology group: K08354, thiosulfate reductase cytochrome b subunit (inferred from 100% identity to dvl:Dvul_0241)

Predicted SEED Role

"Cytochrome B561"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726G3 at UniProt or InterPro

Protein Sequence (202 amino acids)

>DVU3145 hydrogenase, b-type cytochrome subunit, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNTERLYLYTRFERFWHWAQTLLILVLLVTGFEIHGTYRLFGFETAFTVHNACAWTWFVL
YAFIVFWMATTGEWKHYVPTFLKLMDVVRYYVSGIFKGEPHPVPKSERSKHNPLQRLTYL
GIVSVLVPFQMVTGFLYYTYNQWPAFGFAGALTLQVVAVLHTVGAFAFLAFVIVHVYMTT
TGHTLTAHIKAMFTGYEDVPRH