Protein Info for DVU3131 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: transcriptional regulator, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 PF13545: HTH_Crp_2" amino acids 23 to 53 (31 residues), 29.2 bits, see alignment (E = 7.1e-11) PF04198: Sugar-bind" amino acids 62 to 308 (247 residues), 193.7 bits, see alignment E=3.3e-61

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU3131)

Predicted SEED Role

"Erythritol transcriptional regulator EryD" in subsystem Erythritol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726H7 at UniProt or InterPro

Protein Sequence (315 amino acids)

>DVU3131 transcriptional regulator, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MERAQHDHALLSRIAWAYYVNGMTQSDIASWLGTSRVRVNRMLQVCRDEGYVQIMVHSGK
AACFEAEKAMEDRFGLRRAIVIPTPPTPRQLNRNLGHAAGYYLAGILKNGTSVGMGYAAA
ASIPRKPAEHLTVVSLYGGLPHSIVINPYEIVTTIARRVQAEQTFYIAAPMFAPTPETCR
LLKSQALFKAVYARALQVDVALIGLGELAPDATNVQLGAISHDDVESLERAGAVGEVFGT
FVDAEGVPVLHPRNECFMGPDLEEVRAIPHSIAAAGGVKKTGIIRAALSGGFIDVLVTDE
ETATRLLAQHTEAQA