Protein Info for DVU3113 in Desulfovibrio vulgaris Hildenborough JW710

Name: carA
Annotation: carbamoyl-phosphate synthase, small subunit (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01368: carbamoyl-phosphate synthase, small subunit
  • amino acids 3 to 370 (368 residues), 466.9 bits, E=2.1e-144
• PF00988: CPSase_sm_chain
  • amino acids 5 to 130 (126 residues), 178.9 bits, E=5.1e-57
• PF00117: GATase
  • amino acids 192 to 367 (176 residues), 152.2 bits, E=2.1e-48

Best Hits

Swiss-Prot: 100% identical to CARA_DESVH: Carbamoyl-phosphate synthase small chain (carA) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K01956, carbamoyl-phosphate synthase small subunit [EC: 6.3.5.5] (inferred from 100% identity to dvu:DVU3113)

Predicted SEED Role

"Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)" in subsystem De Novo Pyrimidine Synthesis or Macromolecular synthesis operon (EC 6.3.5.5)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (16/18 steps found)
• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• UMP biosynthesis II (6/6 steps found)
• UMP biosynthesis III (6/6 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
• L-citrulline degradation (3/3 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• UMP biosynthesis I (5/6 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• L-glutamate and L-glutamine biosynthesis (4/7 steps found)
• superpathway of arginine and polyamine biosynthesis (11/17 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)
• allantoin degradation IV (anaerobic) (2/9 steps found)
• guadinomine B biosynthesis (2/13 steps found)

KEGG Metabolic Maps

• Glutamate metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.5

Use Curated BLAST to search for 6.3.5.5

Sequence Analysis Tools

See Q726J4 at UniProt or InterPro

Protein Sequence (375 amino acids)

>DVU3113 carbamoyl-phosphate synthase, small subunit (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRALLALEDGFVLEGRSFTGPGETGGEAIFNTGMTGYQEVLTDPSYAGQMVCMTYPLVGN
YGVTREDMESGKVHVEAFIVKECCKVPSNWRSEISLPDYLKRHGVMGIEGIDTRALTRHL
RIHGAMRGVISTQETDPARLVERARALPSMEGQNLVTRVAPAAPYRWDGERPQAVTLEPG
GCAWVGKGPRLVVYDFGIKWNILRLLAQQGFDMLVVPPSFKAADVAAVGAQAVFLSNGPG
DPATLKDEIAEIAKLAQTYPTAGICLGHQLLGHALGGRTMKLKFGHHGCNHPVKDLTTGR
IEISSQNHGFCVDIDSLTDVEITHVNLNDGTLEGFAHKTKPVIAVQHHPEASPGPNDSRY
FFARFRNMVREAAGC