Protein Info for DVU3111 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: transcriptional regulator, Crp/Fnr family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 PF00027: cNMP_binding" amino acids 28 to 109 (82 residues), 35 bits, see alignment E=1.7e-12 PF13545: HTH_Crp_2" amino acids 209 to 256 (48 residues), 35.8 bits, see alignment 9.8e-13 PF00325: Crp" amino acids 210 to 239 (30 residues), 28.2 bits, see alignment (E = 1.9e-10)

Best Hits

KEGG orthology group: None (inferred from 99% identity to dvl:Dvul_0270)

Predicted SEED Role

"transcriptional regulator, Crp/Fnr family" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726J6 at UniProt or InterPro

Protein Sequence (269 amino acids)

>DVU3111 transcriptional regulator, Crp/Fnr family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRLPRCHGPLLRGLNLPWAKALGGGVTREYGTGEIFHQMGDRVDALHYVLEGHVVAKAVT
PEGVERYVLGFLPGTIFGQSPFFNRAPAETLFVSVGHTVAVALGRDYIYGEVAQRHPSLL
LNLLESDAYRHRVFGRHIADATLRDLETRLCRFILHLVTEASDPVPVEQALTDAAAEVHP
RTGDEGAEGPADCPARCHSGASALFSHPGLTHEDVARYLGLHRVTVSNLLGGLRRAGVLG
QFNRKVIEVCDGAELVARAGMSGDGDRWP