Protein Info for DVU3109 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: iron-sulfur cluster-binding protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 66 PF12797: Fer4_2" amino acids 2 to 21 (20 residues), 25.2 bits, see alignment E=4.5e-09 PF12837: Fer4_6" amino acids 3 to 24 (22 residues), 27.6 bits, see alignment E=8.2e-10 PF13237: Fer4_10" amino acids 4 to 52 (49 residues), 25.8 bits, see alignment E=3.4e-09 PF00037: Fer4" amino acids 4 to 25 (22 residues), 29.9 bits, see alignment E=1.4e-10 PF12800: Fer4_4" amino acids 8 to 21 (14 residues), 21.5 bits, see alignment 8.6e-08 amino acids 40 to 55 (16 residues), 12 bits, see alignment 9.8e-05 PF13187: Fer4_9" amino acids 9 to 55 (47 residues), 30.3 bits, see alignment E=1.4e-10 PF12838: Fer4_7" amino acids 10 to 56 (47 residues), 36.5 bits, see alignment E=2.2e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU3109)

Predicted SEED Role

"Adenylylsulfate reductase beta-subunit (EC 1.8.99.2)" in subsystem Anaerobic respiratory reductases (EC 1.8.99.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.99.2

Use Curated BLAST to search for 1.8.99.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726J8 at UniProt or InterPro

Protein Sequence (66 amino acids)

>DVU3109 iron-sulfur cluster-binding protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPVAIDKEACTRCGQCERECPGDVLRMDPETGYPYNAHIDDCWYCGVCEVECHFGALRMT
FPVMVV