Protein Info for DVU3100 in Desulfovibrio vulgaris Hildenborough JW710

Name: tolR
Annotation: biopolymer transport protein, ExbD/TolR family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 transmembrane" amino acids 17 to 38 (22 residues), see Phobius details TIGR02801: protein TolR" amino acids 12 to 131 (120 residues), 129.5 bits, see alignment E=5.9e-42 PF02472: ExbD" amino acids 13 to 132 (120 residues), 104.6 bits, see alignment E=2e-34

Best Hits

KEGG orthology group: K03559, biopolymer transport protein ExbD (inferred from 100% identity to dvl:Dvul_0281)

Predicted SEED Role

"Biopolymer transport protein ExbD/TolR" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726K7 at UniProt or InterPro

Protein Sequence (139 amino acids)

>DVU3100 biopolymer transport protein, ExbD/TolR family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MGASVGNKGGFVAEINVTPFVDVMLVLLIIFMVTAPMMSEGLEVDLPQTRTVEVLPTDSD
HLVLTIRKDGVMYLDEYKVVPEELEDYLRRLVKEKNKTLFLHADKDVPYGVVVDVMGRIK
GAGIEKLGVVAEREDPKKK